Comparison

Recombinant Human Complement C4-B(C4B)?partial

Item no. CSB-EP313364HU-50
Manufacturer Cusabio
Amount 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence EAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADV TLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVL LYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYD YYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEG KCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQ VKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQ MRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGH PQY
Citations Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.Ramachandran P., Boontheung P., Xie Y., Sondej M., Wong D.T., Loo J.A.J. Proteome Res. 5:1493-1503(2006)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Basic complement C4C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3
Available
Manufacturer - Targets
C4B
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
49.1 kDa
General Research Areas
Immunology
Relevance
Non-enzymatic component of the C3 and C5 convertases and thus essential for the propagation of the classical complent pathway. Covalently binds to immunoglobulins and immune complexes and enhances the solubilization of immune aggregates and the clearance of IC through CR1 on erythrocytes. C4A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens, while C4B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens.Derived from proteolytic degradation of complent C4, C4a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.
Expression Region
1454-1744aa
Protein Length
Partial
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Non-enzymatic component of the C3 and C5 convertases and thus essential for the propagation of the classical complement pathway. Covalently binds to immunoglobulins and immune complexes and enhances the solubilization of immune aggregates and the clearance of IC through CR1 on erythrocytes. C4A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens, while C4B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens.; FUNCTION
Subcellular Location
Secreted, Cell junction, synapse, Cell projection, axon, Cell projection, dendrite
Tissue Specificity
Complement component C4 is expressed at highest levels in the liver, at moderate levels in the adrenal cortex, adrenal medulla, thyroid gland, and the kidney, and at lowest levels in the heart, ovary, small intestine, thymus, pancreas and spleen. The extra-hepatic sites of expression may be important for the local protection and inflammatory response.
Involvement in disease
Systemic lupus erythematosus (SLE); Complement component 4B deficiency (C4BD)
Biological activity
Not Test
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close