Recombinant Human papillomavirus type 16 Protein E6(E6)

Epigenetics and Nuclear Signaling

Not Test

Homo sapiens (Human)

MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIIL ECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVC DKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCD LLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWT GRCMSCCRSSRTRRETQL

1-158aa

23.2 kDa

Cellular and molecular biological aspects of cervical intraepithelial neoplasia.Kisseljov F., Sakharova O., Kondratjeva T.Int. Rev. Cytol. 271:35-95(2008)

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.

Plays a major role in the induction and maintenance of cellular transformation. Acts mainly as an oncoprotein by stimulating the destruction of many host cell key regulatory proteins. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase, and inactivates tumor suppressors TP53 and TP73 by targeting them to the 26S proteasome for degradation. In turn, DNA damage and chromosomal instabilities increase and lead to cell proliferation and cancer development. The complex E6/E6AP targets several other substrates to degradation via the proteasome including host DLG1 or NFX1, a repressor of human telomerase reverse transcriptase (hTERT). The resulting increased expression of hTERT prevents the shortening of telomere length leading to cell immortalization. Other cellular targets including BAK1, Fas-associated death domain-containing protein (FADD) and procaspase 8, are degraded by E6/E6AP causing inhibition of apoptosis. E6 also inhibits immune response by interacting with host IRF3 and TYK2. These interactions prevent IRF3 transcriptional activities and inhibit TYK2-mediated JAK-STAT activation by interferon alpha resulting in inhibition of the interferon signaling pathway.

Papillomaviridae E6 protein family