Comparison

Recombinant Human Squamous cell carcinoma antigen recognized by T-cells 3(SART3) ,partial

Item no. CSB-EP624010HU-200
Manufacturer Cusabio
Amount 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWG DDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGK CAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSI TVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIF SNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRP MFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLP FSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLA YVE
Citations Targeting of U4/U6 small nuclear RNP assembly factor SART3/p110 to Cajal bodies.Stanek D., Rader S.D., Klingauf M., Neugebauer K.M.J. Cell Biol. 160:505-516(2003)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Tat-interacting protein of 110KDA1
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
49.8 kDa
General Research Areas
Cancer
Relevance
U6 snRNP-binding protein that functions as a recycling factor of the splicing machinery. Promotes the initial reassbly of U4 and U6 snRNPs following their ejection from the spliceosome during its maturation . Also binds U6atac snRNPs and may function as a recycling factor for U4atac/U6atac spliceosomal snRNP, an initial step in the assbly of U12-type spliceosomal complex. The U12-type spliceosomal complex plays a role in the splicing of introns with non-canonical splice sites . May also function as a substrate-targeting factor for deubiquitinases like USP4 and USP15. Recruits USP4 to ubiquitinated PRPF3 within the U4/U5/U6 tri-snRNP complex, promoting PRPF3 deubiquitination and thereby regulating the spliceosome U4/U5/U6 tri-snRNP spliceosomal complex disassbly . May also recruit the deubiquitinase USP15 to histone H2B and mediate histone deubiquitination, thereby regulating gene expression and/or DNA repair . May play a role in hatopoiesis probably through transcription regulation of specific genes including MYC .
Expression Region
600-900aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
U6 snRNP-binding protein that functions as a recycling factor of the splicing machinery. Promotes the initial reassembly of U4 and U6 snRNPs following their ejection from the spliceosome during its maturation
Subcellular Location
Nucleus, nucleoplasm, Nucleus, Cajal body, Nucleus speckle, Cytoplasm
Tissue Specificity
Ubiquitously expressed.
Gene Names
SART3
Sequence Info
Partial
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close