Comparison

Recombinant Human Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3(ALKBH3)

Item no. CSB-EP847209HU-200
Manufacturer Cusabio
Amount 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLH QKPGQTWKNKEHHLSDREFVFKEPQQVVRRAPEPR VIEEGVYEISLSPTGVSRVCLYPGFVDVKEADWIL EQLCQDVPWKQRTGIREDSILQLTFKKSAPVSGTA TAPQSCWYERPSPPHIPGPAILTRTRLWAP
Protein Family AlkB family
Citations Homo sapiens mRNA expressed in prostate cancer and thymus.Tsujikawa K., Konishi N., Ono Y., Ichijou T., Sakamoto K., Yamamoto H. NIEHS SNPs programHuman chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Alkylated DNA repair protein alkB homolog 3DEPC-1;Prostate cancer antigen 1
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
35.3 kDa
General Research Areas
Epigenetics and Nuclear Signaling
Relevance
Dioxygenase that repairs alkylated DNA containing 1-methyladenine (1meA) and 3-methylcytosine (3meC) by oxidative dethylation. Has a strong preference for single-stranded DNA. Able to process alkylated 3mC within double-stranded regions via its interaction with ASCC3, which promotes DNA unwinding to generate single-stranded substrate needed for ALKHB3. May also act on RNA. Requires molecular oxygen, alpha-ketoglutarate and iron.
Expression Region
1-170aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Dioxygenase that mediates demethylation of DNA and RNA containing 1-methyladenosine (m1A)
Subcellular Location
Nucleus, Cytoplasm
Tissue Specificity
Ubiquitous. Detected in heart, pancreas, skeletal muscle, thymus, testis, ovary, spleen, prostate, small intestine, peripheral blood leukocytes, urinary bladder and colon.
Gene Names
ALKBH3
Sequence Info
Full Length of Isoform 2
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close