« Back
Home /
Recombinant Human Neuronal acetylcholine receptor subunit alpha-3(CHRNA3),partial

Recombinant Human Neuronal acetylcholine receptor subunit alpha-3(CHRNA3),partial

Item no.	CSB-BP005389HU1-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEV SMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPS DYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDK TKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQ NCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGE WAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
Protein Family	Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-3/CHRNA3 sub-subfamily
Citations	"Structure of the Bordetella pertussis gene coding for the serotype 3 fimbrial subunit." Mooi F.R., Ter Avest A., van der Heide H.G.J. FEMS Microbiol. Lett. 54:327-331(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Conjugate / Tag	C-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	26.6 kDa
Relevance	Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B.pertussis are prime candidates for being involved in this process.
Expression Region	32-240aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Subcellular Location	Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein
Gene Names	CHRNA3
Sequence Info	Extracellular Domain
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-BP005389HU1-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 8/28/2025

Compare

Add to wishlist

Get an offer

Request delivery time