« Back
Home /
Recombinant Human Folate receptor beta(FOLR2),partial

Recombinant Human Folate receptor beta(FOLR2),partial

Item no.	CSB-BP008786HU1-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 50 ug 500 ug
Category	Oncology Food Safety Vitamines By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	Baculovirus-Infected Insect Cells
Conjugate/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSP WKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEP ACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERF LDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTS GVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKV SNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH VN
Protein Family	Folate receptor family
Citations	"Folate coenzyme and antifolate transport proteins in normal and neoplastic cells." Freisheim J.H., Price E.M., Ratnam M. Adv. Enzyme Regul. 29:13-26(1989)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Folate receptor 2,Folate receptor,fetal/placental,Placental folate-binding protein
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	27.1 kDa
General Research Areas	Metabolism
Relevance	Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.
Expression Region	19-230aa
Protein Length	Partial
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.
Subcellular Location	Cell membrane, Lipid-anchor, GPI-anchor, Secreted
Tissue Specificity	Expressed in placenta and hematopoietic cells. Expression is increased in malignant tissues.
Pathway	Endocytosis
Biological activity	Not Test
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-BP008786HU1-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 11/27/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer