« Back
Home /
Recombinant Human adenovirus C serotype 5 DNA-binding protein(DBP),partial

Recombinant Human adenovirus C serotype 5 DNA-binding protein(DBP),partial

Item no.	CSB-BP365892HIL-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	SVPIVSAWEKGMEAARALMDKYHVDNDLKANFKLL PDQVEALAAVCKTWLNEEHRGLQLTFTSKKTFVTM MGRFLQAYLQSFAEVTYKHHEPTGCALWLHRCAEI EGELKCLHGSIMINKEHVIEMDVTSENGQRALKEQ SSKAKIVKNRWGRNVVQISNTDARCCVHDAACPAN QFSGKSCGMFFSEGAKAQVAFKQIKAFMQALYPNA QTGHGHLLMPLRCECNSKPGHAPFLGRQLPKLTPF ALS
Protein Family	Adenoviridae E2A DNA-binding protein family
Citations	"Mislocalization of the MRN complex prevents ATR signaling during adenovirus infection." Carson C.T., Orazio N.I., Lee D.V., Suh J., Bekker-Jensen S., Araujo F.D., Lakdawala S.S., Lilley C.E., Bartek J., Lukas J., Weitzman M.D. EMBO J. 28:652-662(2009)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Early 2A protein (Early E2A DNA-binding protein) (DBP)
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	42.3 kDa
General Research Areas	Cancer
Relevance	Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.
Expression Region	174-529aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.
Subcellular Location	Host nucleus
Gene Names	DBP
Sequence Info	Partial
Organism	Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-BP365892HIL-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 9/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer