« Back
Home /
Recombinant Mouse Heat-stable enterotoxin receptor(Gucy2c),partial

Recombinant Mouse Heat-stable enterotoxin receptor(Gucy2c),partial

Item no.	CSB-BP664972MO-100
Manufacturer	Cusabio
Amount	100 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Conjugate/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	VFWASQVRQNCRNGSYEISVLMMDNSAYKEPMQNL REAVEEGLDIVRKRLREADLNVTVNATFIYSDGLI HKSGDCRSSTCEGLDLLREITRDHKMGCALMGPSC TYSTFQMYLDTELNYPMISAGSYGLSCDYKETLTR ILPPARKLMYFLVDFWKVNNASFKPFSWNSSYVYK NGSEPEDCFWYLNALEAGVSYFSEVLNFKDVLRRS EQFQEILTGHNRKSNVIVMCGTPESFYDVKGDLQV AED
Protein Family	Adenylyl cyclase class-4/guanylyl cyclase family
Citations	Guanylin and uroguanylin induce natriuresis in mice lacking guanylyl cyclase-C receptor. Carrithers S.L., Ott C.E., Hill M.J., Johnson B.R., Cai W., Chang J.J., Shah R.G., Sun C., Mann E.A., Fonteles M.C., Forte L.R., Jackson B.A., Giannella R.A., Greenberg R.N. Kidney Int. 65:40-53(2004)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Guanylyl cyclase C (GC-C) (Intestinal guanylate cyclase) (Guc2c)
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	51.1 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Microbiology
Relevance	Receptor for the E.coli heat-stable enterotoxin (E.coli enterotoxin markedly stimulates the accumulation of cGMP in mammalian cells expressing GC-C). Also activated by the endogenous peptide guanylin.
Expression Region	20-433aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for the E.coli heat-stable enterotoxin (E.coli enterotoxin markedly stimulates the accumulation of cGMP in mammalian cells expressing GC-C). Also activated by the endogenous peptide guanylin (By similarity).
Subcellular Location	Cell membrane, Single-pass type I membrane protein, Endoplasmic reticulum membrane, Single-pass type I membrane protein
Gene Names	Gucy2c
Sequence Info	Extracellular Domain
Organism	Mus musculus (Mouse)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-BP664972MO-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 11/20/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer