« Back
Home /
Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase(acpS)

Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase(acpS)

Item no.	CSB-BP669769SBAF-20
Manufacturer	Cusabio
Amount	20 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Baculovirus-Infected Insect Cells
Conjugate/Tag	Myc, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQEL AIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGR LTFQDIEILNDVRGCPILTKSPFKGNSFISISHSG NYVQASVILEDKK
Protein Family	P-Pant transferase superfamily, AcpS family
Citations	"Genome sequence of a serotype M28 strain of group A Streptococcus: potential new insights into puerperal sepsis and bacterial disease specificity." Green N.M., Zhang S., Porcella S.F., Nagiec M.J., Barbian K.D., Beres S.B., Lefebvre R.B., Musser J.M. J. Infect. Dis. 192:760-770(2005)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	4'-phosphopantetheinyl transferase AcpS (Holo-ACP synthase)
Available
Manufacturer - Targets	acpS
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	17.1 kDa
Relevance	Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.
Expression Region	1-118aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.
Subcellular Location	Cytoplasm
Biologically active	Not Test
Protein length	Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-BP669769SBAF-20-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer