« Back
Home /
Recombinant Rat Sclerostin domain-containing protein 1(Sostdc1)

Recombinant Rat Sclerostin domain-containing protein 1(Sostdc1)

Item no.	CSB-BP734096RA-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Baculovirus-Infected Insect Cells
Conjugate/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	FKNDATEILYSHVVKPVSAHPSSNSTLNQARNGGR HFSSTGLDRNSRVQVGCRELRSTKYISDGQCTSIS PLKELVCAGECLPLPVLPNWIGGGYGTKYWSRRSS QEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTAC KCKRYTRQHNESSHNFESVSPAKPAQHHRERKRAS KSSKHSLS
Protein Family	Sclerostin family
Citations	"Uterine sensitization-associated gene-1: a novel gene induced within the rat endometrium at the time of uterine receptivity/sensitization for the decidual cell reaction." Simmons D.G., Kennedy T.G. Biol. Reprod. 67:1638-1645(2002)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Uterine sensitization-associated gene 1 protein
Available
Manufacturer - Targets	Sostdc1
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	24.6 kDa
General Research Areas	Signal Transduction
Relevance	Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner. May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction. Enhances Wnt signaling and inhibits TGF-beta signaling.
Expression Region	24-206aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner (By similarity). May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction. Enhances Wnt signaling and inhibits TGF-beta signaling.
Subcellular Location	Secreted
Tissue Specificity	Highly expressed within the maximally sensitized/receptive endometrium. Weakly expressed in brain, kidney and the female reproductive tract. Expressed in the dermal papilla (DP) and at high level in the precortex of both anagen vibrissae and pelage follicles. Dynymic expression during the hair cycle.
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-BP734096RA-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 10/2/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer