« Back
Home /
Recombinant Human Repulsive guidance molecule A(RGMA)

Recombinant Human Repulsive guidance molecule A(RGMA)

Item no.	CSB-BP836186HUd8-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Baculovirus-Infected Insect Cells
Conjugate/Tag	MBP, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	PHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTP VLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDE LPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQ AKYIGTTIVVRQVGRYLTFAVRMPEEVVNAVEDWD SQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLA AASPAPTAPETFPYETAVAKCKEKLPVEDLYYQAC VFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHL YER
Protein Family	Repulsive guidance molecule (RGM) family
Citations	"Inactivation of Ras by p120GAP via focal adhesion kinase dephosphorylation mediates RGMa-induced growth cone collapse." Endo M., Yamashita T. J. Neurosci. 29:6649-6662(2009)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	RGM domain family member A; RGM
Available
Manufacturer - Targets	RGMA
Manufacturer - Conjugate / Tag	N-terminal MBP-tagged and C-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	72.5 kDa
General Research Areas	Neuroscience
Relevance	Member of the repulsive guidance molecule (RGM) family that performs several functions in the developing and adult nervous system. Regulates cephalic neural tube closure, inhibits neurite outgrowth and cortical neuron branching, and the formation of mature synapses. Binding to its receptor NEO1/neogenin induces activation of RHOA-ROCK1/Rho-kinase signaling pathway through UNC5B-ARHGEF12/LARG-PTK2/FAK1 cascade, leading to collapse of the neuronal growth cone and neurite outgrowth inhibition. Furthermore, RGMA binding to NEO1/neogenin leads to HRAS inactivation by influencing HRAS-PTK2/FAK1-AKT1 pathway. It also functions as a bone morphogenetic protein (BMP) coreceptor that may signal through SMAD1, SMAD5, and SMAD8.
Expression Region	169-424aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Member of the repulsive guidance molecule (RGM) family that performs several functions in the developing and adult nervous system. Regulates cephalic neural tube closure, inhibits neurite outgrowth and cortical neuron branching, and the formation of mature synapses. Binding to its receptor NEO1/neogenin induces activation of RHOA-ROCK1/Rho-kinase signaling pathway through UNC5B-ARHGEF12/LARG-PTK2/FAK1 cascade, leading to collapse of the neuronal growth cone and neurite outgrowth inhibition. Furthermore, RGMA binding to NEO1/neogenin leads to HRAS inactivation by influencing HRAS-PTK2/FAK1-AKT1 pathway. It also functions as a bone morphogenetic protein (BMP) coreceptor that may signal through SMAD1, SMAD5, and SMAD8.
Subcellular Location	Cell membrane, Lipid-anchor, GPI-anchor
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-BP836186HUd8-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer