« Back
Home /
Recombinant Mouse Mannan-binding lectin serine protease 2(Masp2),partial

Recombinant Mouse Mannan-binding lectin serine protease 2(Masp2),partial

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	500ug
Host	Baculovirus-Infected Insect Cells
Item no.	CSB-BP856307MO-500
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Cardiovascular
Uniprot ID	Q91WP0
Gene Names	Masp2
Organism	Mus musculus (Mouse)
AA Sequence	SKWPEPVFGRLVSPGFPEKYADHQDRSWTLTAPPG YRLRLYFTHFDLELSYRCEYDFVKLSSGTKVLATL CGQESTDTEQAPGNDTFYSLGPSLKVTFHSDYSNE KPFTGFEAFYAAEDVDECRVSLGDSVPCDHYCHNY LGGYYCSCRAGYVLHQNKHTCSALCSGQVFTGRSG YLSSPEYPQPYPKLSSCTYSIRLEDGFSVILDFVE SFDVETHPEAQCPYDSLKIQTDKGEHGPFCGKTLP PRIETDSHKVTITFATDESGNHTGWKIHYTSTARP CPDPTAPPNGSISPVQAIYVLKDRFSVFCKTGFEL LQGSVPLKSFTAVCQKDGSWDRPMPECSIIDCGPP DDLPNGHVDYITGPEVTTYKAVIQYSCEETFYTMS SNGKYVCEADGFWTSSKGEKLPPVCEPVCGLSTHT IGGRIVGGQPAKPGDFPWQVLLLGQTTAAAGALIH DNWVLTAAHAVYEKRMAASSLNIRMGILKRLSPHY TQAWPEEIFIHEGYTHGAGFDNDIALIKLKNKVTI NGSIMPVCLPRKEAASLMRTDFTGTVAGWGLTQKG LLARNLMFVDIPIADHQKCTAVYEKLYPGVRVSAN MLCAGLETGGKDSCRGDSGGALVFLDNETQRWFVG GIVSWGSINCGAADQYGVYTKVINYIPWIENIISN
Expression Region	20-685aa
Sequence Info	Extracellular Domain
Source	Baculovirus
Tag Info	N-terminal 6xHis-tagged
MW	75.4 kDa
Alternative Name(s)	MBL-associated serine protease 2 Mannose-binding protein-associated serine protease 2 Short name:MASP-2
Relevance	Serum protease that plays an important role in the activation of the complement system via mannose-binding lectin. After activation by auto-catalytic cleavage it cleaves C2 and C4, leading to their activation and to the formation of C3 convertase (By similarity).
Reference	Two lineages of mannose-binding lectin-associated serine protease (MASP) in vertebrates.Endo Y., Takahashi M., Nakao M., Saiga H., Sekine H., Matsushita M., Nonaka M., Fujita T.J. Immunol. 161:4924-4930(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Serum protease that plays an important role in the activation of the complement system via mannose-binding lectin. After activation by auto-catalytic cleavage it cleaves C2 and C4, leading to their activation and to the formation of C3 convertase (By similarity).
Subcellular Location	Secreted
Protein Families	Peptidase S1 family
Tissue Specificity	Plasma.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time