Comparison

Recombinant Mouse LIM and senescent cell antigen-like-containing domain protein 1(Lims1)

Item no. CSB-BP859129MO-20
Manufacturer Cusabio
Amount 20 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Mouse (Murine, Mus musculus)
Host Baculovirus-Infected Insect Cells
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ANALASATCERCKGGFAPAEKIVNSNGELYHEQCF VCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPCC HQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLAD IGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAI IDEQPLIFKNDPYHPDHFNCANCGKELTADARELK GELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQ WHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQ LFG
Citations PINCH1 plays an essential role in early murine embryonic development but is dispensable in ventricular cardiomyocytes.
Liang X., Zhou Q., Li X., Sun Y., Lu M., Dalton N., Ross J. Jr., Chen J.
Mol. Cell. Biol. 25:3056-3062(2005)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Particularly interesting new Cys-His protein 1 (PINCH-1) (Pinch1)
Available
Manufacturer - Targets
Lims1
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
39.6 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Cancer
Relevance
Adapter protein in a cytoplasmic complex linking beta-integrins to the actin cytoskeleton, bridges the complex to cell surface receptor tyrosine kinases and growth factor receptors. Involved in the regulation of cell survival, cell proliferation and cell differentiation.
Biologically Active
Not Test
Expression Region
2-325aa
Protein Length
Full Length of Mature Protein
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Adapter protein in a cytoplasmic complex linking beta-integrins to the actin cytoskeleton, bridges the complex to cell surface receptor tyrosine kinases and growth factor receptors. Involved in the regulation of cell survival, cell proliferation and cell differentiation.
Subcellular Location
Cell junction, focal adhesion, Cell membrane, Peripheral membrane protein, Cytoplasmic side

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close