« Back
Home /
Recombinant Mouse Transmembrane protease serine 6(Tmprss6),partial

Recombinant Mouse Transmembrane protease serine 6(Tmprss6),partial

Item no.	CSB-BP880561MO-100
Manufacturer	Cusabio
Amount	100 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 50 ug 500 ug
Category	Oncology Food Safety Proteins Peptides & Proteins Recombinant Proteins By Organ Uterine, Ovarian & Cervical Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	KAEVTVSQVYSGSLRVLNRHFSQDLGRRESIAFRS ESAKAQKMLQELVASTRLGTYYNSSSVYSFGEGPL TCFFWFILDIPEYQRLTLSPEVVRELLVDELLSNS STLASYKTEYEVDPEGLVILEASVNDIVVLNSTLG CYRYSYVNPGQVLPLKGPDQQTTSCLWHLQGPEDL MIKVRLEWTRVDCRDRVAMYDAAGPLEKRLITSVY GCSRQEPVMEVLASGSVMAVVWKKGMHSYYDPFLL SVK
Protein Family	Peptidase S1 family
Citations	Membrane anchored serine proteases: a rapidly expanding group of cell surface proteolytic enzymes with potential roles in cancer. Netzel-Arnett S., Hooper J.D., Szabo R., Madison E.L., Quigley J.P., Bugge T.H., Antalis T.M. Cancer Metastasis Rev. 22:237-258(2003)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Matriptase-2
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	86.1 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Cell Biology
Relevance	Serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. Can also activate urokinase-type plasminogen activator with low efficiency. May play a specialized role in matrix remodeling processes in liver. Through the cleavage of HFE2, a regulator of the expression of the iron absorption-regulating hormone hepicidin/HAMP, plays a role in iron homeostasis.
Expression Region	81-811aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. Can also activate urokinase-type plasminogen activator with low efficiency. May play a specialized role in matrix remodeling processes in liver. Through the cleavage of HFE2, a regulator of the expression of the iron absorption-regulating hormone hepicidin/HAMP, plays a role in iron homeostasis.
Subcellular Location	Cell membrane, Single-pass type II membrane protein
Tissue Specificity	Expressed at highest levels in adult mice liver, kidney and uterus. Also strongly expressed within the nasal cavity by olfactory epithelial cells. A weak, but detectable, signal in adult mice tissues analyzed including brain, lung, heart, kidney, spleen, muscle, intestine, thymus and pancreas. No signal in residual embryonic yolk sac, developing kidney tubules or in embryonic tissues analyzed including lung, heart, gastrointestinal tract and epithelium of the oral cavity.
Gene Names	Tmprss6
Sequence Info	Extracellular Domain
Organism	Mus musculus (Mouse)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-BP880561MO-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer