Comparison

Recombinant Human Receptor-interacting serine/threonine-protein kinase 3(RIPK3)

Item no. CSB-BP897497HU-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Baculovirus-Infected Insect Cells
Conjugate/Tag Myc, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTV FRAQHRKWGYDVAVKIVNSKAISREVKAMASLDNE FVLRLEGVIEKVNWDQDPKPALVTKFMENGSLSGL LQSQCPRPWPLLCRLLKEVVLGMFYLHDQNPVLLH RDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTG SGEPGGTLGYLAPELFVNVNRKASTASDVYSFGIL MWAVLAGREVELPTEPSLVYEAVCNRQNRPSLAEL PQA
Protein Family Protein kinase superfamily, TKL Ser/Thr protein kinase family
Citations "Identification of RIP3, a RIP-like kinase that activates apoptosis and NFkappaB."
Yu P.W., Huang B.C.B., Shen M., Quast J., Chan E., Xu X., Nolan G.P., Payan D.G., Luo Y.
Curr. Biol. 9:539-542(1999)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias RIP-like protein kinase 3; Receptor-interacting protein 3
Available
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
60.9 kDa
General Research Areas
Cell Biology
Relevance
Essential for necroptosis, a programmed cell death process in response to death-inducing TNF-alpha family members. Upon induction of necrosis, RIPK3 interacts with, and phosphorylates RIPK1 and MLKL to form a necrosis-inducing complex. RIPK3 binds to and enhances the activity of three metabolic enzymes: GLUL, GLUD1, and PYGL. These metabolic enzymes may eventually stimulate the tricarboxylic acid cycle and oxidative phosphorylation, which could result in enhanced ROS production.
Expression Region
1-518aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Essential for necroptosis, a programmed cell death process in response to death-inducing TNF-alpha family members. Upon induction of necrosis, RIPK3 interacts with, and phosphorylates RIPK1 and MLKL to form a necrosis-inducing complex. RIPK3 binds to and enhances the activity of three metabolic enzymes
Subcellular Location
Cytoplasm, cytosol, Cell membrane, Mitochondrion
Tissue Specificity
Highly expressed in the pancreas. Detected at lower levels in heart, placenta, lung and kidney. Isoform 3 is significantly increased in colon and lung cancers.
Paythway
TNFsignalingpathway
Gene Names
RIPK3
Sequence Info
Full Length
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close