« Back
Home /
Recombinant Human B-lymphocyte antigen CD19(CD19),partial

Recombinant Human B-lymphocyte antigen CD19(CD19),partial

Item no.	CSB-CF004888HUc7-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	PEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSR ESPLKPFLKLSLGLPGLGIHMRPLAIWLFIFNVSQ QMGGFYLCQPGPPSEKAWQPGWTVNVEGSGELFRW NVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVW AKDRPEIWEGEPPCLPPRDSLNQSLSQDLTMAPGS TLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLE LKDDRPARDMWVMETGLLLPRATAQDAGKYYCHRG NLT
Citations	"Isolation of cDNAs encoding the CD19 antigen of human and mouse B lymphocytes. A new member of the immunoglobulin superfamily."Tedder T.F., Isaacs C.M.J. Immunol. 143:712-717(1989)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	B-lymphocyte surface antigen B4; Differentiation antigen CD19; T-cell surface antigen Leu-12; CD_antigen: CD19
Available
Manufacturer - Conjugate / Tag	C-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	30.8 kDa
General Research Areas	Immunology
Relevance	Assembles with the antigen receptor of B-lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.
Expression Region	20-291aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Assembles with the antigen receptor of B-lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.
Subcellular Location	Membrane, Single-pass type I membrane protein
Involvement in disease	Immunodeficiency, common variable, 3 (CVID3)
Paythway	PI3K-Aktsignalingpathway
Gene Names	CD19
Sequence Info	Extracellular Domain
Organism	Homo sapiens(Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-CF004888HUc7-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer