« Back
Home /
Recombinant Human CLIP-associating protein 2(CLASP2)

Recombinant Human CLIP-associating protein 2(CLASP2)

Manufacturer	Cusabio
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Breast Cancer Heart & Blood Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	50ug
Item no.	CSB-CF005472HU-50
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Cell Biology
Uniprot ID	O75122
Gene Names	CLASP2
Organism	Homo sapiens(Human)
AA Sequence	MRRLICKRICDYKSFDDEESVDGNRPSSAASAFKV PAPKTSGNPANSARKPGSAGGPKVGGASKEGGAGA VDEDDFIKAFTDVPSIQIYSSRELEETLNKIREIL SDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHL RLLDGALKLSAKDLRSQVVREACITVAHLSTVLGN KFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFI IRHTHVPRLIPLITSNCTSKSVPVRRRSFEFLDLL LQEWQTHSLERHAAVLVETIKKGIHDADAEARVEA RKTYMGLRNHFPGEAETLYNSLEPSYQKSLQTYLK SSGSVASLPQSDRSSSSSQESLNRPFSSKWSTANP STVAGRVSAGSSKASSLPGSLQRSRSDIDVNAAAG AKAHHAAGQSVRSGRLGAGALNAGSYASLECEAFW RSGRTAKLYSV
Expression Region	1-431aa
Sequence Info	Full Length of Isoform 2
Source	in vitro E.coli expression system
Tag Info	N-terminal 6xHis-B2M-tagged
MW	60.5 kDa
Alternative Name(s)	Cytoplasmic linker-associated protein 2 Protein Orbit homolog 2 Short name: hOrbit2
Relevance	Microtubule plus-end tracking protein that promotes the stabilization of dynamic microtubules (PubMed:26003921). Involved in the nucleation of noncentrosomal microtubules originating from the trans-Golgi network (TGN). Required for the polarization of the cytoplasmic microtubule arrays in migrating cells towards the leading edge of the cell. May act at the cell cortex to enhance the frequency of rescue of depolymerizing microtubules by attaching their plus-ends to cortical platforms composed of ERC1 and PHLDB2 (PubMed:16824950). This cortical microtubule stabilizing activity is regulated at least in part by phosphatidylinositol 3-kinase signaling. Also performs a similar stabilizing function at the kinetochore which is essential for the bipolar alignment of chromosomes on the mitotic spindle (PubMed:16866869, PubMed:16914514). Acts as a mediator of ERBB2-dependent stabilization of microtubules at the cell cortex.
Reference	"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Microtubule plus-end tracking protein that promotes the stabilization of dynamic microtubules
Subcellular Location	Cytoplasm, cytoskeleton, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Chromosome, centromere, kinetochore, Cytoplasm, cytoskeleton, spindle, Golgi apparatus, Golgi apparatus, trans-Golgi network, Cell membrane, Cell projection, ruffle membrane
Protein Families	CLASP family
Tissue Specificity	Brain-specific.
Tag Information	N-terminal 6xHis-B2M-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time