« Back
Home /
Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)

Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)

Item no.	CSB-CF021173HU-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Human
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVC RVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLV CRLVLRCSM
Citations	"cDNA and deduced amino acid sequence of human pulmonary surfactant-associated proteolipid SPL(Phe)." Glasser S.W., Korfhagen T.R., Weaver T., Pilot-Matias T., Fox J.L., Whitsett J.A. Proc. Natl. Acad. Sci. U.S.A. 84:4007-4011(1987)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	18KDA pulmonary-surfactant protein; 6KDA protein; Pulmonary surfactant-associated proteolipid SPL(Phe)
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	24.7 kDa
General Research Areas	Cell Biology
Relevance	Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Expression Region	201-279aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Subcellular Location	Secreted, extracellular space, surface film
Involvement in disease	Pulmonary surfactant metabolism dysfunction 1 (SMDP1); Respiratory distress syndrome in premature infants (RDS)
Gene Names	SFTPB
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens(Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-CF021173HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer