« Back
Home /
Recombinant Pig Transcobalamin-1(TCN1)

Recombinant Pig Transcobalamin-1(TCN1)

Item no.	CSB-CF023317PI-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Category	Food Safety Vitamines Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLS QRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQ LALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEE IKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSIS NVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVK RSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMV VSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTR CLT
Protein Family	Eukaryotic cobalamin transport proteins family
Citations	"Isolation and characterization of a cDNA encoding porcine gastric haptocorrin." Hewitt J.E., Seetharam B., Leykam J.F., Alpers D.H. Eur. J. Biochem. 189:125-130(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cobalophilin,Haptocorrin,Protein R,Transcobalamin I
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	48.3 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Signal Transduction
Relevance	Binds vitamin B12 with femtomolar affinity and protects it from the acidic environment of the stomach. Binds to cobalamin and to cobalamin analogs such as cobinamide.
Expression Region	25-416aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds vitamin B12 with femtomolar affinity and protects it from the acidic environment of the stomach (By similarity). Binds to cobalamin and to cobalamin analogs such as cobinamide.
Subcellular Location	Secreted
Tissue Specificity	Haptocorrins are a family of cobalamin-binding glycoproteins found in blood, salivary and mucosal secretions.
Gene Names	TCN1
Sequence Info	Full Length of Mature Protein
Organism	Sus scrofa (Pig)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-CF023317PI-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 11/27/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer