« Back
Home /
Recombinant Chlamydomonas reinhardtii Photosystem I reaction center subunit VI, chloroplastic(PSAH)

Recombinant Chlamydomonas reinhardtii Photosystem I reaction center subunit VI, chloroplastic(PSAH)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Recombinant Proteins
Specific against	other
Amount	10ug
Item no.	CSB-CF321099DSJ
eClass 6.1	34160400
eClass 9.0	42020190
Available
Uniprot NO.	P13352
Tag Info	His-SUMO-tag
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	Store at -20C, for extended storage, conserve at -20C or -80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
AA sequence	KYGENSRYFDLQDMENTTGSWDMYGVDEKKRYPDN QAKFFTQATDIISRRESLRALVALS GIAAIVTYG LKGAKDADLPITKGPQTTGENGKGGSVRSRL
Protein Names	Recommended name = Photosystem I reaction center subunit VI, chloroplastic Short name = PSI-H Alternative name(s):Light-harvesting complex I 11 kDa protein P28 protein
Gene Names	Name:PSAH
Expression Region	31-130
Sequence Info	full length protein
Species info	Chlamydomonas reinhardtii (Chlamydomonas smithii)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time