« Back
Home /
Recombinant Arachis hypogaea Allergen Ara h 1, clone P41B

Recombinant Arachis hypogaea Allergen Ara h 1, clone P41B

Item no.	CSB-CF337356ANE-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Category	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	KSSPYQKKTENPCAQRCLQSCQQEPDDLKQKACES RCTKLEYDPRCVYDPRGHTGTTNQRSPPGERTRGR QPGDYDDDRRQPRREEGGRWGPAGPREREREEDWR QPREDWRRPSHQQPRKIRPEGREGEQEWGTPGSHV REETSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFD QRSRQFQNLQNHRIVQIEAKPNTLVLPKHADADNI LVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGF ISY
Protein Family	7S seed storage protein family
Citations	"Structure and organization of the genomic clone of a major peanut allergen gene, Ara h 1." Viquez O.M., Konan K.N., Dodo H.W. Mol. Immunol. 40:565-571(2003)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Allergen Ara h I,Allergen: Ara h 1
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	72.8 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Allergen
Expression Region	26-626aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Sequence Info	Full Length of Mature Protein
Organism	Arachis hypogaea (Peanut)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-CF337356ANE-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 1/15/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer