Comparison

Recombinant Sindbis virus Structural polyprotein,partial

Item no. CSB-CF361018SHZ-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 10 ug 100 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Conjugate/Tag Myc, SUMO, HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence YEHATTVPNVPQIPYKALVERAGYAPLNLEITVMS SEVLPSTNQEYITCKFTTVVPSPKIKCCGSLECQP AAHADYTCKVFGGVYPFMWGGAQCFCDSENSQMSE AYVELSADCASDHAQAIKVHTAAMKVGLRIVYGNT TSFLDVYVNGVTPGTSKDLKVIAGPISASFTPFDH KVVIHRGLVYNYDFPEYGAMKPGAFGDIQATSLTS KDLIASTDIRLLKPSAKNVHVPYTQASSGFEMWKN NSG
Protein Family Alphavirus structural polyprotein family
Citations "A single nucleotide change in the E2 glycoprotein gene of Sindbis virus affects penetration rate in cell culture and virulence in neonatal mice."
Davis N.L., Fuller F.J., Dougherty W.G., Olmsted R.A., Johnston R.E.
Proc. Natl. Acad. Sci. U.S.A. 83:6771-6775(1986)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias p130
Available
Manufacturer - Conjugate / Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
67.4 kDa
Relevance
Capsid protein possesses a protease activity that results in its autocatalytic cleavage from the nascent structural protein. Following its self-cleavage, the capsid protein transiently associates with ribosomes, and within several minutes the protein binds to viral RNA and rapidly assembles into icosaedric core particles. The resulting nucleocapsid eventually associates with the cytoplasmic domain of E2 at the cell membrane, leading to budding and formation of mature virions. New virions attach to target cells, and after clathrin-mediated endocytosis their membrane fuses with the host endosomal membrane. This leads to the release of the nucleocapsid into the cytoplasm, followed by an uncoating event necessary for the genomic RNA to become accessible. The uncoating might be triggered by the interaction of capsid proteins with ribosomes. Binding of ribosomes would release the genomic RNA since the same region is genomic RNA-binding and ribosome-binding
Expression Region
807-1245aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Capsid protein
Subcellular Location
Capsid protein: Virion, Host cytoplasm, Host cell membrane, SUBCELLULAR LOCATION: Precursor of protein E2: Virion membrane, Single-pass type I membrane protein, Host cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Spike glycoprotein E2: Virion membrane, Single-pass type I membrane protein, Host cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Protein 6K: Host cell membrane, Multi-pass membrane protein, Virion membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Spike glycoprotein E1: Virion membrane, Single-pass type I membrane protein, Host cell membrane, Single-pass type I membrane protein
Sequence Info
Partial
Organism
Sindbis virus (SINV)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close