« Back
Home /
Recombinant Rat Integrin beta-4(Itgb4),partial

Recombinant Rat Integrin beta-4(Itgb4),partial

Item no.	CSB-CF727354RAa2-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Category	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins By Organ Renal Cancer Neuronal Cell Markers
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	SUMO, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	SLTENVEEFWDKLQGERISGNLDAPEGGFDAILQT AVCTRDIGWRADSTHLLVFSTESAFHYEADGANVL AGIMNRNDEKCHLDATGAYTQYKTQDYPSVPTLVR LLAKHNIIPIFAVTNYSYSYYEKLHKYFPVSSLGV LQEDSSNIVELLEEAFYRIRSNLDIRALDSPRGLR TEVTSDTLQKTETGSFHIKRGEVGTYNVHLRAVED IDGTHVCQLAKEDQRGNIHLKPSFSDGLRMDASVI CDM
Protein Family	Integrin beta chain family
Citations	"Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues." Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V. Nat. Commun. 3:876-876(2012)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GP150; CD_antigen: CD104
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	92.2 kDa
General Research Areas	Signal Transduction
Relevance	Integrin alpha-6/beta-4 is a receptor for laminin. It plays a critical structural role in the hemidesmosome of epithelial cells. Is required for the regulation of keratinocyte polarity and motility. ITGA6:ITGB4 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling. ITGA6:ITGB4 binds to IGF1 and this binding is essential for IGF1 signaling
Expression Region	28-713aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Integrin alpha-6/beta-4 is a receptor for laminin. It plays a critical structural role in the hemidesmosome of epithelial cells. Is required for the regulation of keratinocyte polarity and motility. ITGA6
Subcellular Location	Cell membrane, Single-pass type I membrane protein, Cell membrane, Lipid-anchor, Cell junction, hemidesmosome
Gene Names	Itgb4
Sequence Info	Extracellular Domain
Organism	Rattus norvegicus (Rat)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-CF727354RAa2-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer