« Back
Home /
Recombinant Deinococcus radiodurans Protein CrcB homolog(crcB)

Recombinant Deinococcus radiodurans Protein CrcB homolog(crcB)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Recombinant Proteins
Specific against	other
Amount	10ug
Item no.	CSB-CF865781DJA
eClass 6.1	34160400
eClass 9.0	42020190
Available
Uniprot NO.	Q9RXX0
Tag Info	His-SUMO-tag
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	Store at -20C, for extended storage, conserve at -20C or -80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
AA sequence	MSFPLWLWLALGGAVGAVCRQAAVLLLAPLVARTG FPAAVLLINVLGSFLLGLTLALTGR GVWPEAVRM TFGTGVLGAFTTFSTFSTELDGLLLRGQGGLALAY AALSVGLGLTAAVAGR VLGARL
Protein Names	Recommended name = Protein CrcB homolog
Gene Names	Name:crcB Ordered Locus Names: DR_0185
Expression Region	1-126
Sequence Info	full length protein
Species info	Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time