« Back
Home /
Recombinant Human Aldo-keto reductase family 1 member C4(AKR1C4)

Recombinant Human Aldo-keto reductase family 1 member C4(AKR1C4)

Item no.	CSB-EP001545HU-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAV EVTKLAIEAGFRHIDSAYLYNNEEQVGLAIRSKIA DGSVKREDIFYTSKLWCTFFQPQMVQPALESSLKK LQLDYVDLYLLHFPMALKPGETPLPKDENGKVIFD TVDLSATWEVMEKCKDAGLAKSIGVSNFNCRQLEM ILNKPGLKYKPVCNQVECHPYLNQSKLLDFCKSKD IVLVAHSALGTQRHKLWVDPNSPVLLEDPVLCALA KKH
Protein Family	Aldo/keto reductase family
Citations	"Substrate specificity, gene structure, and tissue-specific distribution of multiple human 3 alpha-hydroxysteroid dehydrogenases." Khanna M., Qin K.-N., Wang R.W., Cheng K.-C. J. Biol. Chem. 270:20162-20168(1995)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	3-alpha-HSD1; 3-alpha-hydroxysteroid dehydrogenase type I ; Chlordecone reductase
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	64.1 kDa
General Research Areas	Signal Transduction
Relevance	Catalyzes the transformation of the potent androgen dihydrotestosterone (DHT) into the less active form, 5-alpha-androstan-3-alpha, 17-beta-diol (3-alpha-diol). Also has some 20-alpha-hydroxysteroid dehydrogenase activity. The biotransformation of the pesticide chlordecone (kepone) to its corresponding alcohol leads to increased biliary excretion of the pesticide and concomitant reduction of its neurotoxicity since bile is the major excretory route.
Expression Region	1-323aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the transformation of the potent androgen dihydrotestosterone (DHT) into the less active form, 5-alpha-androstan-3-alpha, 17-beta-diol (3-alpha-diol). Also has some 20-alpha-hydroxysteroid dehydrogenase activity. The biotransformation of the pesticide chlordecone (kepone) to its corresponding alcohol leads to increased biliary excretion of the pesticide and concomitant reduction of its neurotoxicity since bile is the major excretory route.
Subcellular Location	Cytoplasm
Tissue Specificity	Liver specific.
Involvement in disease	46, XY sex reversal 8 (SRXY8)
Gene Names	AKR1C4
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP001545HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer