Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP001827RA-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Immunology |
Uniprot ID |
P15684 |
Gene Names |
Anpep |
Organism |
Rattus norvegicus (Rat) |
AA Sequence |
YAQEKNRNAENSAIAPTLPGSTSATTSTTNPAIDE SKPWNQYRLPKTLIPDSYQVTLRPYLTPNEQGLYI FKGSSTVRFTCNETTNVIIIHSKKLNYTNKGNHRV ALRALGDTPAPNIDTTELVERTEYLVVHLQGSLVK GHQYEMDSEFQGELADDLAGFYRSEYMEGGNKKVV ATTQMQAADARKSFPCFDEPAMKASFNITLIHPNN LTALSNMLPKDSRTLQEDPSWNVTEFHPTPKMSTY LLAYIVSEFKYVEAVSPNRVQIRIWARPSAIDEGH GDYALQVTGPILNFFAQHYNTAYPLEKSDQIALPD FNAGAMENWGLVTYRESALVFDPQSSSISNKERVV TVIAHELAHQWFGNLVTVDWWNDLWLNEGFASYVE FLGADYAEPTWNLKDLIVLNDVYRVMAVDALASSH PLSSPANEVNTPAQISELFDSITY |
Expression Region |
33-476aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
65.8 kDa |
Alternative Name(s) |
Short name: AP-N Short name: rAPN Alternative name(s): Alanyl aminopeptidase Aminopeptidase M Short name: AP-M Kidney Zn peptidase Short name: KZP Microsomal aminopeptidase CD_antigen: CD13 |
Relevance |
Broad specificity aminopeptidase. Plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. May be involved in the metabolism of regulatory peptides of diverse cell types, responsible for the processing of peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines and involved the cleavage of peptides bound to major histocompatibility complex class II molecules of antigen presenting cells. May have a role in angiogenesis |
Reference |
"Molecular cloning and amino acid sequence of rat kidney aminopeptidase M: a member of a super family of zinc-metallohydrolases."Malfroy B., Kado-Fong H., Gros C., Giros B., Schwartz J.C., Hellmiss R.Biochem. Biophys. Res. Commun. 161:236-241(1989) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Broad specificity aminopeptidase which plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Also involved in the processing of various peptides including peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines. May also be involved the cleavage of peptides bound to major histocompatibility complex class II molecules of antigen presenting cells. May have a role in angiogenesis and promote cholesterol crystallization. |
Subcellular Location |
Cell membrane, Single-pass type II membrane protein |
Protein Families |
Peptidase M1 family |
Tissue Specificity |
Widely distributed throughout the CNS. Particularly abundant in kidney and intestinal microvilli, also detected in lung and liver. Weakly expressed in heart and aorta. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.