« Back
Home /
Recombinant Rat Aminopeptidase N(Anpep),partial

Recombinant Rat Aminopeptidase N(Anpep),partial

Manufacturer	Cusabio
Category	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	500ug
Host	E.coli
Item no.	CSB-EP001827RA-500
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Immunology
Uniprot ID	P15684
Gene Names	Anpep
Organism	Rattus norvegicus (Rat)
AA Sequence	YAQEKNRNAENSAIAPTLPGSTSATTSTTNPAIDE SKPWNQYRLPKTLIPDSYQVTLRPYLTPNEQGLYI FKGSSTVRFTCNETTNVIIIHSKKLNYTNKGNHRV ALRALGDTPAPNIDTTELVERTEYLVVHLQGSLVK GHQYEMDSEFQGELADDLAGFYRSEYMEGGNKKVV ATTQMQAADARKSFPCFDEPAMKASFNITLIHPNN LTALSNMLPKDSRTLQEDPSWNVTEFHPTPKMSTY LLAYIVSEFKYVEAVSPNRVQIRIWARPSAIDEGH GDYALQVTGPILNFFAQHYNTAYPLEKSDQIALPD FNAGAMENWGLVTYRESALVFDPQSSSISNKERVV TVIAHELAHQWFGNLVTVDWWNDLWLNEGFASYVE FLGADYAEPTWNLKDLIVLNDVYRVMAVDALASSH PLSSPANEVNTPAQISELFDSITY
Expression Region	33-476aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	65.8 kDa
Alternative Name(s)	Short name: AP-N Short name: rAPN Alternative name(s): Alanyl aminopeptidase Aminopeptidase M Short name: AP-M Kidney Zn peptidase Short name: KZP Microsomal aminopeptidase CD_antigen: CD13
Relevance	Broad specificity aminopeptidase. Plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. May be involved in the metabolism of regulatory peptides of diverse cell types, responsible for the processing of peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines and involved the cleavage of peptides bound to major histocompatibility complex class II molecules of antigen presenting cells. May have a role in angiogenesis
Reference	"Molecular cloning and amino acid sequence of rat kidney aminopeptidase M: a member of a super family of zinc-metallohydrolases."Malfroy B., Kado-Fong H., Gros C., Giros B., Schwartz J.C., Hellmiss R.Biochem. Biophys. Res. Commun. 161:236-241(1989)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Broad specificity aminopeptidase which plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Also involved in the processing of various peptides including peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines. May also be involved the cleavage of peptides bound to major histocompatibility complex class II molecules of antigen presenting cells. May have a role in angiogenesis and promote cholesterol crystallization.
Subcellular Location	Cell membrane, Single-pass type II membrane protein
Protein Families	Peptidase M1 family
Tissue Specificity	Widely distributed throughout the CNS. Particularly abundant in kidney and intestinal microvilli, also detected in lung and liver. Weakly expressed in heart and aorta.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP001827RA-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time