Comparison

Recombinant Human Apolipoprotein C-I(APOC1)

Item no. CSB-EP001930HUb0-500
Manufacturer Cusabio
Amount 500 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Conjugate/Tag HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence TPDVSSALDKLKEFGNTLEDKARELISRIKQSELS AKMREWFSETFQKVKEKLKIDS
Protein Family Apolipoprotein C1 family
Citations "Isolation and characterisation of a cDNA clone for human apolipoprotein CI and assignment of the gene to chromosome 19."
Tata F., Henry I., Markham A.F., Wallis S.C., Weil D., Grzeschik K.H., Junien C., Williamson R., Humphries S.E.
Hum. Genet. 69:345-349(1985)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Apolipoprotein C1 (Apo-CI) (ApoC-I)
Available
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
12.7 kDa
Buffer
Tris-based buffer, 50% glycerol
General Research Areas
Cardiovascular
Relevance
Inhibitor of lipoprotein binding to the low density lipoprotein receptor, LDL receptor-related protein, and very low density lipoprotein receptor. Associates with high density lipoproteins and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein. Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.
Expression Region
27-83aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.
Subcellular Location
Secreted
Tissue Specificity
Synthesized mainly in liver and to a minor degree in intestine. Also found in the lung and spleen.
Pathway
Cholesterolmetabolism
Gene Names
APOC1
Sequence Info
Full Length of Mature Protein
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close