Comparison

Recombinant Human Asporin(ASPN)

Item no. CSB-EP002230HU-500
Manufacturer Cusabio
Amount 500 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DMEDTDDDDDDDDDDDDDDEDNSLFPTREPRSHFF PFDLFPMCPFGCQCYSRVVHCSDLGLTSVPTNIPF DTRMLDLQNNKIKEIKENDFKGLTSLYGLILNNNK LTKIHPKAFLTTKKLRRLYLSHNQLSEIPLNLPKS LAELRIHENKVKKIQKDTFKGMNALHVLEMSANPL DNNGIEPGAFEGVTVFHIRIAEAKLTSVPKGLPPT LLELHLDYNKISTVELEDFKRYKELQRLGLGNNKI TDI
Protein Family Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily
Citations "Mechanisms for asporin function and regulation in articular cartilage."Nakajima M., Kizawa H., Saitoh M., Kou I., Miyazono K., Ikegawa S.J. Biol. Chem. 282:32185-32192(2007).
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Periodontal ligament-associated protein 1; Short name:PLAP-1
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
55.7 kDa
General Research Areas
Signal Transduction
Relevance
Negatively regulates periodontal ligament (PDL) differentiation and mineralization to ensure that the PDL is not ossified and to maintain homeostasis of the tooth-supporting system. Inhibits BMP2-induced cytodifferentiation of PDL cells by preventing its binding to BMPR1B/BMP type-1B receptor, resulting in inhibition of BMP-dependent activation of SMAD proteins (By similarity). Critical regulator of TGF-beta in articular cartilage and plays an essential role in cartilage homeostasis and osteoarthritis (OA) pathogenesis. Negatively regulates chondrogenesis in the articular cartilage by blocking the TGF-beta/receptor interaction on the cell surface and inhibiting the canonical TGF-beta/Smad signal. Binds calcium and plays a role in osteoblast-driven collagen biomineralization activity.
Expression Region
33-380aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Negatively regulates periodontal ligament (PDL) differentiation and mineralization to ensure that the PDL is not ossified and to maintain homeostasis of the tooth-supporting system. Inhibits BMP2-induced cytodifferentiation of PDL cells by preventing its binding to BMPR1B/BMP type-1B receptor, resulting in inhibition of BMP-dependent activation of SMAD proteins (By similarity). Critical regulator of TGF-beta in articular cartilage and plays an essential role in cartilage homeostasis and osteoarthritis (OA) pathogenesis. Negatively regulates chondrogenesis in the articular cartilage by blocking the TGF-beta/receptor interaction on the cell surface and inhibiting the canonical TGF-beta/Smad signal. Binds calcium and plays a role in osteoblast-driven collagen biomineralization activity.
Subcellular Location
Secreted, extracellular space, extracellular matrix
Tissue Specificity
Higher levels in osteoarthritic articular cartilage, aorta, uterus. Moderate expression in small intestine, heart, liver, bladder, ovary, stomach, and in the adrenal, thyroid, and mammary glands. Low expression in trachea, bone marrow, and lung. Colocalizes with TGFB1 in chondrocytes within osteoarthritic (OA) lesions of articular cartilage.
Involvement in disease
Osteoarthritis 3 (OS3); Intervertebral disc disease (IDD)
Gene Names
ASPN
Sequence Info
Full Length of Mature Protein
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close