Comparison

Recombinant Mouse Osteocalcin(Bglap)

Item no. CSB-EP002682MO-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence YLGASVPSPDPLEPTREQCELNPACDELSDQYGLK TAYKRIYGITI
Protein Family Osteocalcin/matrix Gla protein family
Citations "The mouse osteocalcin gene cluster contains three genes with two separate spatial and temporal patterns of expression."Desbois C., Hogue D.A., Karsenty G.J. Biol. Chem. 269:1183-1190(1994)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Bone Gla protein; Short name:; BGP; Gamma-carboxyglutamic acid-containing protein
Available
Manufacturer - Targets
Bglap
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
21.1 kDa
General Research Areas
Signal Transduction
Relevance
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
Expression Region
50-95aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
Subcellular Location
Secreted
Tissue Specificity
Bone.
Biologically active
Not Test
Protein length
Full Length of Mature Protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close