« Back
Home /
Recombinant Human F-actin-capping protein subunit beta(CAPZB)

Recombinant Human F-actin-capping protein subunit beta(CAPZB)

Item no.	CSB-EP004514HU-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSL CEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDS YRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFD QYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDG SKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVML WLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHI ANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRS VQT
Protein Family	F-actin-capping protein beta subunit family
Citations	"Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J. Nat. Biotechnol. 21:566-569(2003)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CapZ beta
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	57.6 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Signal Transduction
Relevance	F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization.
Expression Region	1-272aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization.
Subcellular Location	Cytoplasm, cytoskeleton, Cytoplasm, myofibril, sarcomere
Pathway	Endocytosis
Gene Names	CAPZB
Sequence Info	Full Length of Isoform 2
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP004514HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 11/13/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer