« Back
Home /
Recombinant Human Cystathionine beta-synthase(CBS),partial

Recombinant Human Cystathionine beta-synthase(CBS),partial

Item no.	CSB-EP004589HU(A4)-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPED KEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAP AKSPKILPDILKKIGDTPMVRINKIGKKFGLKCEL LAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGD TIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSS EKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRL KNEIPNSHILDQYRNASNPLAHYDTTADEILQQCD GKL
Citations	Human cystathionine beta-synthase cDNA sequence, alternative splicing and expression in cultured cells.Kraus J.P., Le K., Swaroop M., Ohura T., Tahara T., Rosenberg L.E., Roper M.D., Kozich V.Hum. Mol. Genet. 2:1633-1638(1993)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Beta-thionase;Serine sulfhydrase
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	MW of Fusion: 61, 4
General Research Areas	Metabolism
Relevance	Only known pyridoxal phosphate-dependent enzyme that contains he. Important regulator of hydrogen sulfide, especially in the brain, utilizing cysteine instead of serine to catalyze the formation of hydrogen sulfide. Hydrogen sulfide is a gastratransmitter with signaling and cytoprotective effects such as acting as a neuromodulator in the brain to protect neurons against hypoxic injury .
Expression Region	1-413aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names	CBS
Sequence Info	Partial
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 10/23/2025

Compare

Add to wishlist

Get an offer

Request delivery time