Comparison

Recombinant Human CD44 antigen(CD44),partial

Item no. CSB-EP004938HU-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKA FNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPR IHPNSICAANNTGVYILTSNTSQYDTYCFNASAPP EEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGE YRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIF YTFSTVHPIPDEDSPWITDSTDRIPATSTSSNTIS AGWEPNEENEDERDRHLSFSGSGIDDDEDFISSTI STT
Citations CD44 in normal and neoplastic human cartilage.Bosch P.P., Stevens J.W., Buckwalter J.A., Midura R.J. Sequence analysis of the human CD44 antigen.Wiebe G.J., Freund D., Corbeil D. Sequence analysis of a novel human CD44 variant.Xiang Q., Wang J., Fan C., He X., Huang L., Zhu H., Qiu X., Luo W.Construction of human CD44 eukaryotic vector and its expression in mammary carcinoma cells MCF-7.Fang X., Xu W., Zhang X.The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CDw44Epican;Extracellular domain matrix receptor III ;ECMR-IIIGP90 lymphocyte homing/adhesion receptor;HUTCH-IHeparan sulfate proteoglycan;Hermes antigen;Hyaluronate receptor;Phagocytic glycoprotein 1 ;PGP-1;Phagocytic glycoprotein I ;PGP-I; CD44
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
80.2 kDa
General Research Areas
Immunology
Relevance
Receptor for hyaluronic acid (HA). Mediates cell-cell and cell-matrix interactions through its affinity for HA, and possibly also through its affinity for other ligands such as osteopontin, collagens, and matrix metalloproteinases (MMPs). Adhesion with HA plays an important role in cell migration, tumor growth and progression. In cancer cells, may play an important role in invadopodia formation. Also involved in lymphocyte activation, recirculation and homing, and in hatopoiesis. Altered expression or dysfunction causes numerous pathogenic phenotypes. Great protein heterogeneity due to numerous alternative splicing and post-translational modification events.
Expression Region
21-606aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Receptor for hyaluronic acid (HA). Mediates cell-cell and cell-matrix interactions through its affinity for HA, and possibly also through its affinity for other ligands such as osteopontin, collagens, and matrix metalloproteinases (MMPs). Adhesion with HA plays an important role in cell migration, tumor growth and progression. In cancer cells, may play an important role in invadopodia formation. Also involved in lymphocyte activation, recirculation and homing, and in hematopoiesis. Altered expression or dysfunction causes numerous pathogenic phenotypes. Great protein heterogeneity due to numerous alternative splicing and post-translational modification events. Receptor for LGALS9; the interaction enhances binding of SMAD3 to the FOXP3 promoter, leading to up-regulation of FOXP3 expression and increased induced regulatory T (iTreg) cell stability and suppressive function (By similarity).
Subcellular Location
Cell membrane, Single-pass type I membrane protein
Tissue Specificity
Isoform 10 (epithelial isoform) is expressed by cells of epithelium and highly expressed by carcinomas. Expression is repressed in neuroblastoma cells.
Paythway
Hematopoieticcelllineage
Gene Names
CD44
Sequence Info
Partial of BC004372
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Delivery expected until 9/4/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close