Comparison

Recombinant Mouse CD82 antigen(Cd82) ,partial

Item no. CSB-EP004961MO-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DKLKKEMGNTVMDIIRNYTANATSSREEAWDYVQA QVKCCGWVSHYNWTENEELMGFTKTTYPCSCEKIK EEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGC MEKAQAWLQENF
Protein Family Tetraspanin (TM4SF) family
Citations The mouse C2C12 myoblast cell surface N-linked glycoproteome identification, glycosite occupancy, and membrane orientation.Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.Mol. Cell. Proteomics 8:2555-2569(2009)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias C33 antigenIA4Inducible membrane protein R2Metastasis suppressor Kangai-1 homolog; CD82
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
29.5 kDa
Relevance
Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.
Expression Region
111-227aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.
Subcellular Location
Membrane, Multi-pass membrane protein
Tissue Specificity
Highest expression in the spleen and the kidney. Low expression in skeletal muscle and in the heart.
Gene Names
Cd82
Sequence Info
Extracellular Domain
Organism
Mus musculus (Mouse)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close