« Back
Home /
Recombinant Human Centromere protein H(CENPH)

Recombinant Human Centromere protein H(CENPH)

Item no.	CSB-EP005211HU-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAAC SEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPE QIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDR MRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLI MKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEI QTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITT VIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVD MM
Protein Family	CENP-H/MCM16 family
Citations	"Transcription within a functional human centromere." Saffery R., Sumer H., Hassan S., Wong L.H., Craig J.M., Todokoro K., Anderson M., Stafford A., Choo K.H.A. Mol. Cell 12:509-516(2003)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Interphase centromere complex protein 35
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	55.5 kDa
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. Required for chromosome congression and efficiently align the chromosomes on a metaphase plate.
Expression Region	1-247aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. Required for chromosome congression and efficiently align the chromosomes on a metaphase plate.
Subcellular Location	Nucleus, Chromosome, centromere, kinetochore
Gene Names	CENPH
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP005211HU-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 10/23/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer