« Back
Home /
Recombinant Mouse Complement receptor type 2(Cr2),partial

Recombinant Mouse Complement receptor type 2(Cr2),partial

Manufacturer	Cusabio
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Amount	10ug
Host	E.coli
Item no.	CSB-EP005934MO(F1)-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Alternative Name(s)	Complement C3d receptor CD_antigen: CD21
AA Sequence	ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSY RLIGEKAIFCISENQVHATWDKAPPICESVNKTIS CSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTM KGSKTVWCQANEMWGPTALPVCES
Research Topic	Immunology
Uniprot ID	P19070
Gene Names	Cr2
Tag Info	N-terminal 6xHis-tagged
Expression Region	12-140aa
MW of Fusion Proten	18, 1
Sequence Info	Partial
Relevance	Receptor for complement C3d. Participates in B lymphocytes activation.
Reference	"Comparative structure and evolution of murine CR2. The homolog of the human C3d/EBV receptor (CD21)."Fingeroth J.D.J. Immunol. 144:3458-3467(1990)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Mus musculus (Mouse)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time