« Back
Home /
Recombinant Human Casein kinase I isoform alpha(CSNK1A1)

Recombinant Human Casein kinase I isoform alpha(CSNK1A1)

Item no.	CSB-EP006065HU-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Food Safety Allergenes Neuroscience Molecular Targets for Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAIN ITNGEEVAVKLESQKARHPQLLYESKLYKILQGGV GIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSR RFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDN FLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYR EDKNLTGTARYASINAHLGIEQSRRDDMESLGYVL MYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVE VLC
Protein Family	Protein kinase superfamily, CK1 Ser/Thr protein kinase family, Casein kinase I subfamily
Citations	Cloning and chromosomal localization of the gene coding for human protein kinase CK1.Tapia C., Featherstone T., Gomez C., Taillon-Miller P., Allende C.C., Allende J.E.FEBS Lett. 349:307-312(1994)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CK1
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	42.8 kDa
General Research Areas	Cell Cycle
Relevance	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at 'Ser-45'. May phosphorylate PER1 and PER2. May play a role in segregating chromosomes during mitosis.
Expression Region	2-337aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at 'Ser-45'. May phosphorylate PER1 and PER2. May play a role in segregating chromosomes during mitosis
Subcellular Location	Cytoplasm, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Chromosome, centromere, kinetochore, Nucleus speckle, Cytoplasm, cytoskeleton, cilium basal body
Paythway	Hedgehogsignalingpathway
Gene Names	CSNK1A1
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP006065HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 8/28/2025

Compare

Add to wishlist

Get an offer

Request delivery time