« Back
Home /
Recombinant Human Steroid 17-alpha-hydroxylase/17,20 lyase(CYP17A1)

Recombinant Human Steroid 17-alpha-hydroxylase/17,20 lyase(CYP17A1)

Item no.	CSB-EP006392HU-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Food Safety Hormones Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLP LVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGT KTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIA SNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQ KLEKIICQEISTLCDMLATHNGQSIDISFPVFVAV TNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLS KDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNK ILE
Protein Family	Cytochrome P450 family
Citations	"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	17-alpha-hydroxyprogesterone aldolaseCYPXVIICytochrome P450 17A1Cytochrome P450-C17 ;Cytochrome P450c17Steroid 17-alpha-monooxygenase
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	84.4 kDa
General Research Areas	Metabolism
Relevance	Conversion of pregnenolone and progesterone to their 17-alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17, 20-lyase reaction. Involved in sexual development during fetal life and at puberty.
Expression Region	1-508aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Conversion of pregnenolone and progesterone to their 17-alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17, 20-lyase reaction. Involved in sexual development during fetal life and at puberty.
Subcellular Location	Membrane
Involvement in disease	Adrenal hyperplasia 5 (AH5)
Gene Names	CYP17A1
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP006392HU-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 9/25/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer