« Back
Home /
Recombinant Mouse 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial(Cyp27b1)

Recombinant Mouse 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial(Cyp27b1)

Item no.	CSB-EP006406MO-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MTQAVKLASRVFHRIHLPLQLDASLGSRGSESVLR SLSDIPGPSTLSFLAELFCKGGLSRLHELQVHGAA RYGPIWSGSFGTLRTVYVADPTLVEQLLRQESHCP ERCSFSSWAEHRRRHQRACGLLTADGEEWQRLRSL LAPLLLRPQAAAGYAGTLDNVVRDLVRRLRRQRGR GSGLPGLVLDVAGEFYKFGLESIGAVLLGSRLGCL EAEVPPDTETFIHAVGSVFVSTLLTMAMPNWLHHL IPG
Protein Family	Cytochrome P450 family
Citations	"25-hydroxyvitamin D 1alpha-hydroxylase: structure of the mouse gene, chromosomal assignment, and developmental expression." Panda D.K., Al-Kawas S., Seldin M.F., Hendy G.N., Goltzman D. J. Bone Miner. Res. 16:46-56(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	25-OHD-1 alpha-hydroxylase,25-hydroxyvitamin D(3) 1-alpha-hydroxylase
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	60.2 kDa
Buffer	Tris-based buffer, 50% glycerol
Relevance	Catalyzes the conversion of 25-hydroxyvitamin D3 (25(OH)D3) to 1-alpha, 25-dihydroxyvitamin D3 (1alpha, 25(OH)2D3), and of 24, 25-dihydroxyvitamin D3 (24, 25(OH)2D3) to 1-alpha, 24, 25-trihydroxyvitamin D3 (1alpha, 24, 25(OH)3D3). Is also active with 25-hydroxy-24-oxo-vitamin D3. Plays an important role in normal bone growth, calcium metabolism, and tissue differentiation.
Expression Region	1-507aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the conversion of 25-hydroxyvitamin D3 (25(OH)D3) to 1-alpha, 25-dihydroxyvitamin D3 (1alpha, 25(OH)(2)D3), and of 24, 25-dihydroxyvitamin D3 (24, 25(OH)(2)D3) to 1-alpha, 24, 25-trihydroxyvitamin D3 (1alpha, 24, 25(OH)(3)D3). Is also active with 25-hydroxy-24-oxo-vitamin D3. Plays an important role in normal bone growth, calcium metabolism, and tissue differentiation.
Subcellular Location	Mitochondrion membrane
Tissue Specificity	Kidney.
Gene Names	Cyp27b1
Sequence Info	Full Length
Organism	Mus musculus (Mouse)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP006406MO-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 10/23/2025

Compare

Add to wishlist

Get an offer

Request delivery time