« Back
Home /
Recombinant Rat D-amino-acid oxidase(Dao)

Recombinant Rat D-amino-acid oxidase(Dao)

Item no.	CSB-EP006494RA-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MRVAVIGAGVIGLSTALCIHERYHPAQPLHMKIYA DRFTPFTTSDVAAGLWQPYLSDPSNPQEAEWNQQT FDHLQSCLHSPNAEKMGLALISGYNLFRDEVPDPF WKSTVLGFRKLTPSELDMFPDYSYGWFNTSLLLEG KSYLSWLTERLTERGVKFIHRKVASFEEVVRGGVD VIINCTGVWAGALQADASLQPGRGQIIQVEAPWIK HFILTHDPSLGIYNSPYIIPGSKTVTLGGVFQLGN WSE
Protein Family	DAMOX/DASOX family
Citations	"Rat D-amino-acid oxidase cDNA: rat D-amino-acid oxidase as an intermediate form between mouse and other mammalian D-amino-acid oxidases." Konno R. Biochim. Biophys. Acta 1395:165-170(1998)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Dao1
Available
Manufacturer - Targets	Dao
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	45.8 kDa
General Research Areas	Metabolism
Relevance	Regulates the level of the neuromodulator D-serine in the brain. Has high activity towards D-DOPA and contributes to dopamine synthesis. Could act as a detoxifying agent which removes D-amino acids accumulated during aging. Acts on a variety of D-amino acids with a preference for those having small hydrophobic side chains followed by those bearing polar, aromatic, and basic groups. Does not act on acidic amino acids.
Expression Region	1-346aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Regulates the level of the neuromodulator D-serine in the brain. Has high activity towards D-DOPA and contributes to dopamine synthesis. Could act as a detoxifying agent which removes D-amino acids accumulated during aging. Acts on a variety of D-amino acids with a preference for those having small hydrophobic side chains followed by those bearing polar, aromatic, and basic groups. Does not act on acidic amino acids.
Subcellular Location	Peroxisome
Biologically active	Not Test
Protein length	Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP006494RA-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer