« Back
Home /
Recombinant Human Neuronal migration protein doublecortin(DCX)

Recombinant Human Neuronal migration protein doublecortin(DCX)

Manufacturer	Cusabio
Category	Oncology Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins By Organ Brain Cancer Stem Cell Markers
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	1mg
Host	E.coli
Item no.	CSB-EP006576HU-1
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Neuroscience
Uniprot ID	O43602
Gene Names	DCX
Organism	Homo sapiens (Human)
AA Sequence	MKTLPLHSHCTEMQRLLPKLEMLTLGSSFCSLQGE FCQAMDSFTTVSHVGMCEETDASFNVFSPKFQFDR SHCQSLRFHQNMELDFGHFDERDKTSRNMRGSRMN GLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYR NGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDN INLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSS DNFFKKVEYTKNVNPNWSVNVKTSANMKAPQSLAS SNSAQARENKDFVRPKLVTIIRSGVKPRKAVRVLL NKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGK QVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDEN ECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRS KSPADSANGTSSSQLSTPKSKQSPISTPTSPGSLR KHKDLYLPLSLDDSDSLGDSM
Expression Region	1-441aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	65.3 kDa
Alternative Name(s)	Doublin Lissencephalin-X Short name: Lis-X
Relevance	Microtubule-associated protein required for initial steps of neuronal dispersion and cortex lamination during cerebral cortex development. May act by competing with the putative neuronal protein kinase DCLK1 in binding to a target protein. May in that way participate in a signaling pathway that is crucial for neuronal interaction before and during migration, possibly as part of a calcium ion-dependent signal transduction pathway. May be part with PAFAH1B1/LIS-1 of overlapping, but distinct, signaling pathways that promote neuronal migration.
Reference	A novel CNS gene required for neuronal migration and involved in X-linked subcortical laminar heterotopia and lissencephaly syndrome. Des Portes V., Pinard J.-M., Billuart P., Vinet M.-C., Koulakoff A., Carrie A., Gelot A., Dupuis E., Motte J., Berwald-Netter Y., Catala M., Kahn A., Beldjord C., Chelly J.Cell 92:51-61(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Microtubule-associated protein required for initial steps of neuronal dispersion and cortex lamination during cerebral cortex development. May act by competing with the putative neuronal protein kinase DCLK1 in binding to a target protein. May in that way participate in a signaling pathway that is crucial for neuronal interaction before and during migration, possibly as part of a calcium ion-dependent signal transduction pathway. May be part with PAFAH1B1/LIS-1 of overlapping, but distinct, signaling pathways that promote neuronal migration.
Involvement in disease	Lissencephaly, X-linked 1 (LISX1); Subcortical band heterotopia X-linked (SBHX)
Subcellular Location	Cytoplasm, Cell projection
Tissue Specificity	Highly expressed in neuronal cells of fetal brain (in the majority of cells of the cortical plate, intermediate zone and ventricular zone), but not expressed in other fetal tissues. In the adult, highly expressed in the brain frontal lobe, but very low expression in other regions of brain, and not detected in heart, placenta, lung, liver, skeletal muscles, kidney and pancreas.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP006576HU-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time