Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-EP006576HU-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Neuroscience |
Uniprot ID |
O43602 |
Gene Names |
DCX |
Organism |
Homo sapiens (Human) |
AA Sequence |
MKTLPLHSHCTEMQRLLPKLEMLTLGSSFCSLQGE FCQAMDSFTTVSHVGMCEETDASFNVFSPKFQFDR SHCQSLRFHQNMELDFGHFDERDKTSRNMRGSRMN GLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYR NGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDN INLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSS DNFFKKVEYTKNVNPNWSVNVKTSANMKAPQSLAS SNSAQARENKDFVRPKLVTIIRSGVKPRKAVRVLL NKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGK QVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDEN ECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRS KSPADSANGTSSSQLSTPKSKQSPISTPTSPGSLR KHKDLYLPLSLDDSDSLGDSM |
Expression Region |
1-441aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
65.3 kDa |
Alternative Name(s) |
Doublin Lissencephalin-X Short name: Lis-X |
Relevance |
Microtubule-associated protein required for initial steps of neuronal dispersion and cortex lamination during cerebral cortex development. May act by competing with the putative neuronal protein kinase DCLK1 in binding to a target protein. May in that way participate in a signaling pathway that is crucial for neuronal interaction before and during migration, possibly as part of a calcium ion-dependent signal transduction pathway. May be part with PAFAH1B1/LIS-1 of overlapping, but distinct, signaling pathways that promote neuronal migration. |
Reference |
"A novel CNS gene required for neuronal migration and involved in X-linked subcortical laminar heterotopia and lissencephaly syndrome." Des Portes V., Pinard J.-M., Billuart P., Vinet M.-C., Koulakoff A., Carrie A., Gelot A., Dupuis E., Motte J., Berwald-Netter Y., Catala M., Kahn A., Beldjord C., Chelly J.Cell 92:51-61(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Microtubule-associated protein required for initial steps of neuronal dispersion and cortex lamination during cerebral cortex development. May act by competing with the putative neuronal protein kinase DCLK1 in binding to a target protein. May in that way participate in a signaling pathway that is crucial for neuronal interaction before and during migration, possibly as part of a calcium ion-dependent signal transduction pathway. May be part with PAFAH1B1/LIS-1 of overlapping, but distinct, signaling pathways that promote neuronal migration. |
Involvement in disease |
Lissencephaly, X-linked 1 (LISX1); Subcortical band heterotopia X-linked (SBHX) |
Subcellular Location |
Cytoplasm, Cell projection |
Tissue Specificity |
Highly expressed in neuronal cells of fetal brain (in the majority of cells of the cortical plate, intermediate zone and ventricular zone), but not expressed in other fetal tissues. In the adult, highly expressed in the brain frontal lobe, but very low expression in other regions of brain, and not detected in heart, placenta, lung, liver, skeletal muscles, kidney and pancreas. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.