Comparison

Recombinant Rat Dipeptidyl peptidase 4(Dpp4),partial

Item no. CSB-EP007139RA-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYM GLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGT ADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHG IASSTAHQHIYSHMSHFLQQCFSLR
Protein Family Peptidase S9B family, DPPIV subfamily
Citations Crystal structures of DPP-IV (CD26) from rat kidney exhibit flexible accommodation of peptidase-selective inhibitors.Longenecker K.L., Stewart K.D., Madar D.J., Jakob C.G., Fry E.H., Wilk S., Lin C.W., Ballaron S.J., Stashko M.A., Lubben T.H., Yong H., Pireh D., Pei Z., Basha F., Wiedeman P.E., von Geldern T.W., Trevillyan J.M., Stoll V.S.Biochemistry 45:7474-7482(2006).
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Bile canaliculus domain-specific membrane glycoprotein,Dipeptidyl peptidase IV,Short name:,DPP IV,GP110 glycoprotein,T-cell activation antigen CD26,CD_antigen: CD26,Cleaved into the following 3 chains:,Dipeptidyl peptidase 4 membrane form,Alternative name
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
30.7 kDa
Manufacturer - Alias
Bile canaliculus domain-specific membrane glycoprotein; Dipeptidyl peptidase IV; Short name:; DPP IV; GP110 glycoprotein; T-cell activation antigen CD26; CD_antigen: CD26; Cleaved into the following 3 chains:; Dipeptidyl peptidase 4 membrane form; Alternative name(s):; Dipeptidyl peptidase IV membrane form; Dipeptidyl peptidase 4 soluble form; Alternative name(s):; Dipeptidyl peptidase IV soluble form; Dipeptidyl peptidase 4 60KDA soluble form; Alternative name(s):; Dipeptidyl peptidase IV 60KDA soluble form
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Immunology
Relevance
Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the Extracellular domain matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline.
Expression Region
638-767aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline.
Subcellular Location
Dipeptidyl peptidase 4 soluble form: Secreted, Note=Detected in the serum and the seminal fluid, SUBCELLULAR LOCATION: Cell membrane, Single-pass type II membrane protein, Apical cell membrane, Single-pass type II membrane protein, Cell projection, invadopodium membrane, Single-pass type II membrane protein, Cell projection, lamellipodium membrane, Single-pass type II membrane protein, Cell junction, Membrane raft
Tissue Specificity
Expressed in bile ducts and other epithelial brush borders (small intestine, kidney, colon, pancreatic duct); acinar structures in salivary glands; endothelial structures and T cell areas in thymus, spleen and lymph node.
Gene Names
Dpp4
Sequence Info
Partial
Organism
Rattus norvegicus (Rat)
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close