« Back
Home /
Recombinant Human Receptor-binding cancer antigen expressed on SiSo cells(EBAG9),partial

Recombinant Human Receptor-binding cancer antigen expressed on SiSo cells(EBAG9),partial

Item no.	CSB-EP007355HU-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTS WDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKD MTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLA ATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAW QAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMK KEQNKIGVKLS
Citations	An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cancer-associated surface antigen R;CAS1;Estrogen receptor-binding fragment-associated gene 9 protein
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	37.2 kDa
General Research Areas	Apoptosis
Relevance	May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases.
Expression Region	28-213aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases.
Subcellular Location	Golgi apparatus membrane, Single-pass type III membrane protein
Tissue Specificity	Widely expressed. Expressed in ovary, testis, prostate, thymus, muscle and heart, but not in small intestine, colon, lymph nodes, or peripherical blood lymphocytes. The protein is not detected in any of the above organs.
Paythway	Estrogensignalingpathway
Gene Names	EBAG9
Sequence Info	Cytoplasmic Domain
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP007355HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer