Comparison

Recombinant Human Elongation factor 1-alpha 1(EEF1A1)

Item no. CSB-EP007409HUa0-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGID KRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERG ITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITG TSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA YTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVS TYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPW FKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKP LRL
Protein Family TRAFAC class translation factor GTPase superfamily, Classic translation factor GTPase family, EF-Tu/EF-1A subfamily
Citations "The primary structure of the alpha subunit of human elongation factor 1. Structural aspects of guanine-nucleotide-binding sites."
Brands J.H.G.M., Maassen J.A., van Hemert F.J., Amons R., Moeller W.
Eur. J. Biochem. 155:167-171(1986)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Elongation factor Tu; Short name:; EF-Tu; Eukaryotic elongation factor 1 A-1; Short name:; eEF1A-1; Leukocyte receptor cluster member 7; EEF1A, EF1A, LENG7
Available
Manufacturer - Targets
EEF1A1
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
54.1 kDa
General Research Areas
Epigenetics and Nuclear Signaling
Relevance
This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. With PARP1 and TXK, forms a complex that acts as a T helper 1 (Th1) cell-specific transcription factor and binds the promoter of IFN-gamma to directly regulate its transcription, and is thus involved importantly in Th1 cytokine production.
Expression Region
1-462aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. With PARP1 and TXK, forms a complex that acts as a T helper 1 (Th1) cell-specific transcription factor and binds the promoter of IFN-gamma to directly regulate its transcription, and is thus involved importantly in Th1 cytokine production.
Subcellular Location
Cytoplasm, Nucleus, Nucleus, nucleolus, Cell membrane
Tissue Specificity
Brain, placenta, lung, liver, kidney, pancreas but barely detectable in heart and skeletal muscle.
Biologically active
Not Test
Protein length
Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close