« Back
Home /
Recombinant Mouse Alpha-enolase(Eno1),partial

Recombinant Mouse Alpha-enolase(Eno1),partial

Item no.	CSB-EP007670MOb0-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Food Safety Proteins Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	SILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVP SGASTGIYEALELRDNDKTRFMGKGVSQAVEHINK TIAPALVSKKVNVVEQEKIDKLMIEMDGTENKSKF GANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNP EVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAS SFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEG GFAPNILENKEALELLKTAIAKAGYTDQVVIGMDV AAS
Protein Family	Enolase family
Citations	"Cholesteryl ester loading of mouse peritoneal macrophages is associated with changes in the expression or modification of specific cellular proteins, including increase in an alpha-enolase isoform." Bottalico L.A., Kendrick N.C., Keller A., Li Y., Tabas I. Arterioscler. Thromb. 13:264-275(1993)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	2-phospho-D-glycerate hydro-lyase,Enolase 1,Non-neural enolase
Available
Manufacturer - Targets	Eno1
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	50.4 kDa
General Research Areas	Signal Transduction
Relevance	Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production
Expression Region	2-433aa
Protein Length	Partial
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses (By similarity). May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production (By similarity).
Subcellular Location	Cytoplasm, Cell membrane
Tissue Specificity	Testis. Found in the principal piece of sperm tail (at protein level). The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons. In striated muscle, expression of ENO1 appears to be independent of fiber type.
Biological activity	Not Test
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP007670MOb0-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer