« Back
Home /
Recombinant Bovine Adrenodoxin, mitochondrial(FDX1)

Recombinant Bovine Adrenodoxin, mitochondrial(FDX1)

Item no.	CSB-EP008570BO-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQ NNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAI TDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTV RVPDAVSDARESIDMGMNSSKIE
Protein Family	Adrenodoxin/putidaredoxin family
Citations	"Molecular cloning and amino acid sequence of the precursor form of bovine adrenodoxin: evidence for a previously unidentified COOH-terminal peptide." Okamura T., John M.E., Zuber M.X., Simpson E.R., Waterman M.R. Proc. Natl. Acad. Sci. U.S.A. 82:5705-5709(1985)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Adrenal ferredoxin (Ferredoxin-1) (Hepato-ferredoxin) (ADX)
Available
Manufacturer - Targets	FDX1
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	19.5 kDa
General Research Areas	Metabolism
Relevance	Essential for the synthesis of various steroid hormones. Participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage to produce pregnenolone, the precursor of most steroid hormones. Does not form a ternary complex with adrenodoxin reductase and CYP11A1 but shuttles between the two enzymes to transfer electrons.
Expression Region	59-186aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Essential for the synthesis of various steroid hormones, participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage (By similarity).
Subcellular Location	Mitochondrion matrix
Tissue Specificity	Detected in adrenal cortex and corpus luteum (at protein level).
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP008570BO-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 9/4/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer