Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
1mg |
Host |
E.coli |
Item no. |
CSB-EP008619HU-1 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Areas |
Signal Transduction |
Uniprot ID |
Q92913 |
Gene Names |
FGF13 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGK TSCDKNKLNVFSRVKLFGSKKRRRRRPEPQLKGIV TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLI PVGLRVVAIQGVQTKLYLAMNSEGYLYTSELFTPE CKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNK EGEIMKGNHVKKNKPAAHFLPKPLKVAMYKEPSLH DLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST |
Expression Region |
1-245aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
31.6 kDa |
Alternative Name(s) |
Fibroblast growth factor homologous factor 2 Short name: FHF-2 |
Relevance |
Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules. Through its action on microtubules, may participate to the refinement of axons by negatively regulating axonal and leading processes branching. Plays a crucial role in neuron polarization and migration in the cerebral cortex and the hippocampus. May regulate voltage-gated sodium channels transport and function. May also play a role in MAPK signaling. |
Reference |
Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development.Smallwood P.M., Munoz-Sanjuan I., Tong P., Macke J.P., Hendry S.H., Gilbert D.J., Copeland N.G., Jenkins N.A., Nathans J.Proc. Natl. Acad. Sci. U.S.A. 93:9850-9857(1996) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules. Through its action on microtubules, may participate to the refinement of axons by negatively regulating axonal and leading processes branching. Plays a crucial role in neuron polarization and migration in the cerebral cortex and the hippocampus. |
Subcellular Location |
Cell projection, filopodium, Cell projection, growth cone, Cell projection, dendrite, Nucleus, Cytoplasm |
Protein Families |
Heparin-binding growth factors family |
Tissue Specificity |
Ubiquitously expressed. Predominantly expressed in the nervous system. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.