Comparison

Recombinant Rat Fibroblast growth factor 23(Fgf23)

Item no. CSB-EP008629RA-200
Manufacturer Cusabio
Amount 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDG HVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFL CMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLS PKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEV PLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRA TPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDA RRGAGGTDRCRPFPRFV
Protein Family Heparin-binding growth factors family
Citations Rattus norvegicus fgf23.Itoh N.Klotho converts canonical FGF receptor into a specific receptor for FGF23.Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T.Nature 444:770-774(2006)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
29.5 kDa
Relevance
Regulator of phosphate homeostasis . Inhibits renal tubular phosphate transport by reducing SLC34A1 levels . Regulator of vitamin-D metabolism . Negatively regulates osteoblasts differentiation and matrix mineralization . Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.
Expression Region
25-251aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Regulator of phosphate homeostasis (By similarity). Inhibits renal tubular phosphate transport by reducing SLC34A1 levels (By similarity). Regulator of vitamin-D metabolism (By similarity). Negatively regulates osteoblasts differentiation and matrix mineralization (By similarity). Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.
Subcellular Location
Secreted
Tissue Specificity
Expressed in the parathyroid.
Biologically active
Not Test
Protein length
Full Length of Mature Protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close