Comparison

Recombinant Human Growth/differentiation factor 9(GDF9)

Item no. CSB-EP009352HU-1
Manufacturer Cusabio
Amount 1 mg
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Host E.coli
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECE LHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRA VGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKY SPLSVLTIEPDGSIAYKEYEDMIATKCTCR
Protein Family TGF-beta family
Citations Mutational screening of the coding region of growth differentiation factor 9 gene in Indian women with ovarian failure.Dixit H., Rao L.K., Padmalatha V., Kanakavalli M., Deenadayal M., Gupta N., Chakravarty B., Singh L.Menopause 12:749-754(2005)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
42.5 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Cardiovascular
Relevance
Required for ovarian folliculogenesis. Promotes primordial follicle development. Stimulates granulosa cell proliferation. Promotes cell transition from G0/G1 to S and G2/M phases, through an increase of CCND1 and CCNE1 expression, and RB1 phosphorylation. It regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells. Attenuates the suppressive effects of activin A on STAR expression and progesterone production by increasing the expression of inhibin B. It suppresses FST and FSTL3 production in granulosa-lutein cells.
Expression Region
320-454aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Required for ovarian folliculogenesis. Promotes primordial follicle development. Stimulates granulosa cell proliferation. Promotes cell transition from G0/G1 to S and G2/M phases, through an increase of CCND1 and CCNE1 expression, and RB1 phosphorylation. It regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells. Attenuates the suppressive effects of activin A on STAR expression and progesterone production by increasing the expression of inhibin B. It suppresses FST and FSTL3 production in granulosa-lutein cells.
Subcellular Location
Secreted
Tissue Specificity
Expressed in ovarian granulosa cells. Present in oocytes of primary follicles (at protein level).
Involvement in disease
Altered GDF9 function may be involved in ovarian disorders. Rare variants in GDF9 have been found in patients with premature ovarian failure and mothers of dizygotic twins.
Gene Names
GDF9
Sequence Info
Full Length of Mature Protein
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Delivery expected until 1/15/2026 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close